Recombinant Human TCN2 protein(1-200aa), His-GST-tagged

• Cat.No.: TCN2-5730H
• Product Overview: Recombinant Human TCN2 protein(P20062)(1-200aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 1-200aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVRGHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAG

Gene Information

• Gene Name: TCN2 transcobalamin II [ Homo sapiens ]
• Official Symbol: TCN2
• Synonyms: TCN2; transcobalamin II; transcobalamin II; macrocytic anemia; transcobalamin-2; D22S676; D22S750; macrocytic anemia; TC2; vitamin B12-binding protein 2; II; TC; TC-2; TCII; TC II
• Gene ID: 6948
• mRNA Refseq: NM_000355
• Protein Refseq: NP_000346
• MIM: 613441
• UniProt ID: P20062