Recombinant Human TCF3

Cat.No. : TCF3-29462TH
Product Overview : Recombinant fragment corresponding to amino acids 545-654 of Human TCF3 / E2A with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEK PQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEE KVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name TCF3 transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) [ Homo sapiens ]
Official Symbol TCF3
Synonyms TCF3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor E2-alpha; bHLHb21; E2A; E2A immunoglobulin enhancer binding factor E12/E47; E47; immunoglobulin transcription factor 1; ITF1; kappa E2 binding factor;
Gene ID 6929
mRNA Refseq NM_001136139
Protein Refseq NP_001129611
MIM 147141
Uniprot ID P15923
Chromosome Location 19p13.3
Pathway CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function DNA binding; contributes_to DNA binding; DNA binding; E-box binding; contributes_to E-box binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TCF3 Products

Required fields are marked with *

My Review for All TCF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon