Recombinant Human TCF3

• Cat.No.: TCF3-29462TH
• Product Overview: Recombinant fragment corresponding to amino acids 545-654 of Human TCF3 / E2A with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 110 amino acids
• Description: This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEK PQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEE KVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: TCF3 transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) [ Homo sapiens ]
• Official Symbol: TCF3
• Synonyms: TCF3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor E2-alpha; bHLHb21; E2A; E2A immunoglobulin enhancer binding factor E12/E47; E47; immunoglobulin transcription factor 1; ITF1; kappa E2 binding factor
• Gene ID: 6929
• mRNA Refseq: NM_001136139
• Protein Refseq: NP_001129611
• MIM: 147141
• Uniprot ID: P15923
• Chromosome Location: 19p13.3
• Pathway: CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: DNA binding; contributes_to DNA binding; DNA binding; E-box binding; contributes_to E-box binding