Species :	Human
Source :	Wheat Germ
Tag :	Non
ProteinLength :	348 amino acids
Molecular Weight :	64.390kDa inclusive of tags
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSI QLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLD SPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKK REDPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPK TPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALK ADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRS RISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTY NQVQTRSADEPMTTFVLCNECGNRWKFC
Sequence Similarities :	Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger.

Gene Name	TCEA3 transcription elongation factor A (SII), 3 [ Homo sapiens ]
Official Symbol	TCEA3
Synonyms	TCEA3; transcription elongation factor A (SII), 3; transcription elongation factor A protein 3; TFIIS.H;
Gene ID	6920
mRNA Refseq	NM_003196
Protein Refseq	NP_003187
MIM	604128
Uniprot ID	O75764
Chromosome Location	1p36.11
Function	DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding;

◆ Recombinant Proteins
GSTA1-7324M	Recombinant Mouse GSTA1 Protein	+Inquiry
RFL1193SF	Recombinant Full Length Saccharomyces Cerevisiae Cytochrome B-C1 Complex Subunit 9(Qcr9) Protein, His-Tagged	+Inquiry
TNFRSF17-8829C	Active Recombinant Rhesus TNFRSF17 protein, hFc-tagged	+Inquiry
RFL13357MF	Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 85(Gpr85) Protein, His-Tagged	+Inquiry
LONB-0460B	Recombinant Bacillus subtilis LONB protein, His-tagged	+Inquiry
See All GSTA1 Recombinant Proteins

◆ Native Proteins
Lectin-1804L	Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled	+Inquiry
Lectin-1718P	Native Peanut Lectin, PE conjugated	+Inquiry
FABP-173C	Native Canine Fatty acid Binding Protein	+Inquiry
APOC2-27332TH	Native Human APOC2	+Inquiry
C.Pneumoniae-32	Native Chlamydia pneumoniae Antigen	+Inquiry
See All Lectin Native Proteins

◆ Cell & Tissue Lysates
GSTCD-5715HCL	Recombinant Human GSTCD 293 Cell Lysate	+Inquiry
F10-719HCL	Recombinant Human F10 cell lysate	+Inquiry
CHST6-7506HCL	Recombinant Human CHST6 293 Cell Lysate	+Inquiry
MS4A1-819CCL	Recombinant Cynomolgus MS4A1 cell lysate	+Inquiry
PROCR-1174RCL	Recombinant Rat PROCR cell lysate	+Inquiry
See All GSTCD Cell & Tissue Lysates

COA

Cat.No. :	TCEA3-30320TH
Product Overview :	Recombinant full length Human TFIISH with a N terminal proprietary tag; Predicted MWt 64.39 kDa.

Recombinant Human TCEA3