Recombinant Human TBXAS1 protein(381-460 aa), C-His-tagged

• Cat.No.: TBXAS1-2701H
• Product Overview: Recombinant Human TBXAS1 protein(P24557)(381-460 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 381-460 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEA

Gene Information

• Gene Name: TBXAS1 thromboxane A synthase 1 (platelet) [ Homo sapiens ]
• Official Symbol: TBXAS1
• Synonyms: TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771
• Gene ID: 6916
• mRNA Refseq: NM_001061
• Protein Refseq: NP_001052
• MIM: 274180
• UniProt ID: P24557