Recombinant Human TBXAS1, GST-tagged
Cat.No. : | TBXAS1-3147H |
Product Overview : | Recombinant Human TBXAS1(1 a.a. - 466 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 77.00 kDa |
AA Sequence : | MELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGALMSA FSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFF EFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPM GVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKL LREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDP EHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESK SALGPKNGVYIKIVSR |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TBXAS1 thromboxane A synthase 1 (platelet) [ Homo sapiens (human) ] |
Official Symbol | TBXAS1 |
Synonyms | TBXAS1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V); thromboxane-A synthase; CYP5; CYP5A1; cytochrome P450; family 5; subfamily A; polypeptide 1; THAS; TS; TXAS; TXS; TXA synthase; cytochrome P450 5A1; platelet, cytochrome P450, subfamily V; cytochrome P450, family 5, subfamily A, polypeptide 1; thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); GHOSAL; BDPLT14; FLJ52771 |
Gene ID | 6916 |
mRNA Refseq | NM_001061 |
Protein Refseq | NP_001052 |
MIM | 274180 |
UniProt ID | P24557 |
Chromosome Location | 7q34-q35 |
Pathway | Arachidonic acid metabolism; Biological oxidations; Defective CYP19A1 causes Aromatase excess syndrome (AEXS); Defective CYP21A2 causes Adrenal hyperplasia 3 (AH3) |
Function | heme binding; monooxygenase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
◆ Recombinant Proteins | ||
TBXAS1-16537M | Recombinant Mouse TBXAS1 Protein | +Inquiry |
RFL15629MF | Recombinant Full Length Macaca Fascicularis Thromboxane-A Synthase(Tbxas1) Protein, His-Tagged | +Inquiry |
RFL32399SF | Recombinant Full Length Pig Thromboxane-A Synthase(Tbxas1) Protein, His-Tagged | +Inquiry |
TBXAS1-5638R | Recombinant Rat TBXAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TBXAS1-7843H | Recombinant Human TBXAS1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBXAS1-1196HCL | Recombinant Human TBXAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBXAS1 Products
Required fields are marked with *
My Review for All TBXAS1 Products
Required fields are marked with *
0
Inquiry Basket