Recombinant Human TBX21 protein, T7/His-tagged
Cat.No. : | TBX21-195H |
Product Overview : | Recombinant human T-bet cDNA (535aa, which derived from BC039739) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADE RRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPR EDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHW RYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHI VEVNDGEPEAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNC QFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRG QEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDS KRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | TBX21 T-box 21 [ Homo sapiens ] |
Official Symbol | TBX21 |
Synonyms | TBX21; T-box 21; T-box transcription factor TBX21; T bet; TBLYM; T-box protein 21; T-box expressed in T cells; transcription factor TBLYM; TBET; T-PET; T-bet; |
Gene ID | 30009 |
mRNA Refseq | NM_013351 |
Protein Refseq | NP_037483 |
MIM | 604895 |
UniProt ID | Q9UL17 |
Chromosome Location | 17q21.2 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; |
Function | DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
TBX21-196H | Recombinant Human TBX21 Protein, His-tagged | +Inquiry |
TBX21-3141H | Recombinant Human TBX21, GST-tagged | +Inquiry |
TBX21-3024H | Recombinant Human TBX21 protein, His-tagged | +Inquiry |
Tbx21-1498M | Recombinant Mouse Tbx21 protein, His & T7-tagged | +Inquiry |
TBX21-2143H | Recombinant Human TBX21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX21-1747HCL | Recombinant Human TBX21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBX21 Products
Required fields are marked with *
My Review for All TBX21 Products
Required fields are marked with *
0
Inquiry Basket