Recombinant Human TBK1 protein, GST-tagged
Cat.No. : | TBK1-335H |
Product Overview : | Recombinant Human TBK1(630 a.a. - 729 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 630-729 a.a. |
Description : | The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKEL AENNHILERFGSLTMDGGLRNVDCL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TBK1 TANK-binding kinase 1 [ Homo sapiens ] |
Official Symbol | TBK1 |
Synonyms | TBK1; TANK-binding kinase 1; serine/threonine-protein kinase TBK1; NAK; NF-kB-activating kinase; NF-kappa-B-activating kinase; T2K; FLJ11330; |
Gene ID | 29110 |
mRNA Refseq | NM_013254 |
Protein Refseq | NP_037386 |
MIM | 604834 |
UniProt ID | Q9UHD2 |
Chromosome Location | 12q14.2 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Hepatitis C, organism-specific biosystem; |
Function | ATP binding; nucleic acid binding; nucleotide binding; phosphoprotein binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
TBK1-351HFL | Recombinant Full Length Human TBK1 Protein, C-Flag-tagged | +Inquiry |
TBK1-176HFL | Active Recombinant Full Length Human TBK1 Protein, N-His-tagged | +Inquiry |
TBK1-688HF | Recombinant Full Length Human TBK1 Protein, GST-tagged | +Inquiry |
Tbk1-6316M | Active Recombinant Mouse Tbk1 Protein, GST-tagged | +Inquiry |
TBK1-3904Z | Recombinant Zebrafish TBK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBK1-1745HCL | Recombinant Human TBK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBK1 Products
Required fields are marked with *
My Review for All TBK1 Products
Required fields are marked with *
0
Inquiry Basket