Recombinant Full Length Human TBK1 Protein, C-Flag-tagged
Cat.No. : | TBK1-351HFL |
Product Overview : | Recombinant Full Length Human TBK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.5 kDa |
AA Sequence : | MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL FAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGN IMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVT FYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPV LANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQ ELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLDTIGLIYEKISLPKVHPRYDLDGDASMAKAITG VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINL EAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMT EIYYQFKKDQAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQL LSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGV VKELAENNHILERFGSLTMDGGLRNVDCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | TBK1 TANK binding kinase 1 [ Homo sapiens (human) ] |
Official Symbol | TBK1 |
Synonyms | NAK; T2K; IIAE8; FTDALS4 |
Gene ID | 29110 |
mRNA Refseq | NM_013254.4 |
Protein Refseq | NP_037386.1 |
MIM | 604834 |
UniProt ID | Q9UHD2 |
◆ Recombinant Proteins | ||
TBK1-5832H | Recombinant Human TBK1 Protein (Met1-Gly121), N-His tagged | +Inquiry |
TBK119802H | Recombinant Human TBK1 (1-385)-HIS (D135N) Protein | +Inquiry |
TBK1-335H | Recombinant Human TBK1 protein, GST-tagged | +Inquiry |
TBK1-7347HF | Active Recombinant Full Length Human TBK1 Protein, GST-tagged | +Inquiry |
TBK1-4458R | Recombinant Rhesus Macaque TBK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBK1-1745HCL | Recombinant Human TBK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBK1 Products
Required fields are marked with *
My Review for All TBK1 Products
Required fields are marked with *
0
Inquiry Basket