Recombinant Human TBCA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TBCA-3190H
• Product Overview: TBCA MS Standard C13 and N15-labeled recombinant protein (NP_004598) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.9 kDa
• AA Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TBCA tubulin folding cofactor A [ Homo sapiens (human) ]
• Official Symbol: TBCA
• Synonyms: TBCA; tubulin folding cofactor A; tubulin specific chaperone a; tubulin-specific chaperone A; CFA; chaperonin cofactor A; TCP1-chaperonin cofactor A; tubulin-folding cofactor A
• Gene ID: 6902
• mRNA Refseq: NM_004607
• Protein Refseq: NP_004598
• MIM: 610058
• UniProt ID: O75347