Recombinant Human TAX1BP3, His-tagged

• Cat.No.: TAX1BP3-28609TH
• Product Overview: Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 124 amino acids
• Description: Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene.
• Conjugation: HIS
• Molecular Weight: 15.800kDa inclusive of tags
• Tissue specificity: Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS
• Sequence Similarities: Contains 1 PDZ (DHR) domain.

Gene Information

• Gene Name: TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ]
• Official Symbol: TAX1BP3
• Synonyms: TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1
• Gene ID: 30851
• mRNA Refseq: NM_001204698
• Protein Refseq: NP_001191627
• Uniprot ID: O14907
• Chromosome Location: 17p13
• Pathway: Wnt Signaling Pathway NetPath, organism-specific biosystem
• Function: beta-catenin binding; protein C-terminus binding; protein binding