Recombinant Human TAT, GST-tagged

• Cat.No.: TAT-2502H
• Product Overview: Recombinant Human TAT (1 a.a. - 142 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Cat. No.: TAT-2502H
• Description: This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked.
• Source: wheat germ
• Molecular Mass: 42.3 kDa
• Sequence: MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGELGTLLRGCHCPPLLSCSQAGWRRWQLGVSLSTEHGRITSWLLLCFPPIKRGPYCVWKPAYRP
• Storagebuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: TAT

Gene Information

• Gene Name: TAT tyrosine aminotransferase [ Homo sapiens ]
• Synonyms: TAT; tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5
• Gene ID: 6898
• mRNA Refseq: NM_000353
• Protein Refseq: NP_000344
• MIM: 613018
• UniProt ID: P17735
• Chromosome Location: 16q22.1
• Pathway: 4-hydroxybenzoate biosynthesis; 4-hydroxyphenylpyruvate biosynthesis; Cysteine and methionine metabolism; FOXA2 and FOXA3 transcription factor networks
• Function: L-phenylalanine:2-oxoglutarate aminotransferase activity; L-tyrosine:2-oxoglutarate aminotransferase activity; amino acid binding