Recombinant Human TAS2R10 protein, His-KSI-tagged

• Cat.No.: TAS2R10-6874H
• Product Overview: Recombinant Human TAS2R10 protein(Q9NYW0)(64-100aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• ProteinLength: 64-100a.a.
• Tag: His-KSI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.6 kDa
• AASequence: DGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFAT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TAS2R10 taste receptor, type 2, member 10 [ Homo sapiens ]
• Official Symbol: TAS2R10
• Synonyms: TAS2R10; taste receptor, type 2, member 10; taste receptor type 2 member 10; T2R10; TRB2; taste receptor family B member 2; taste receptor, family B, member 2; MGC126811; MGC126813
• Gene ID: 50839
• mRNA Refseq: NM_023921
• Protein Refseq: NP_076410
• MIM: 604791
• UniProt ID: Q9NYW0