Recombinant Human TARS2 Protein (369-718 aa), His-SUMO-tagged

• Cat.No.: TARS2-824H
• Product Overview: Recombinant Human TARS2 Protein (369-718 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 369-718 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 55.3 kDa
• AA Sequence: EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TARS2 threonyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ]
• Official Symbol: TARS2
• Synonyms: TARS2; FLJ12528; mitochondrial; thrRS; TARSL1
• Gene ID: 80222
• mRNA Refseq: NM_025150
• Protein Refseq: NP_079426
• MIM: 612805
• UniProt ID: Q9BW92