Recombinant Human TANK Protein (1-119 aa), His-tagged
Cat.No. : | TANK-1531H |
Product Overview : | Recombinant Human TANK Protein (1-119 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-119 aa |
Description : | Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining th in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.8 kDa |
AA Sequence : | MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TANK TRAF family member-associated NFKB activator [ Homo sapiens ] |
Official Symbol | TANK |
Synonyms | TANK; TRAF2; I TRAF; TRAF-interacting protein; I-TRAF; |
Gene ID | 10010 |
mRNA Refseq | NM_004180 |
Protein Refseq | NP_004171 |
MIM | 603893 |
UniProt ID | Q92844 |
◆ Recombinant Proteins | ||
TANK-517H | Recombinant Human TANK | +Inquiry |
TANK-4615R | Recombinant Rhesus monkey TANK Protein, His-tagged | +Inquiry |
TANK-518H | Recombinant Human TANK protein, His-T7-tagged | +Inquiry |
TANK-31497TH | Recombinant Human TANK | +Inquiry |
TANK-4431R | Recombinant Rhesus Macaque TANK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TANK-1256HCL | Recombinant Human TANK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TANK Products
Required fields are marked with *
My Review for All TANK Products
Required fields are marked with *
0
Inquiry Basket