Recombinant Human TAF7, His-tagged
Cat.No. : | TAF7-30937TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-349 of Human TAF7 with N terminal His tag, 61.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-349 a.a. |
Description : | The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 76 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLK DRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLK TIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDP KASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKK KYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAEN QGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSED EDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQE NEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMK VENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE K |
Full Length : | Full L. |
Gene Name | TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa [ Homo sapiens ] |
Official Symbol | TAF7 |
Synonyms | TAF7; TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa; TAF2F, TATA box binding protein (TBP) associated factor, RNA polymerase II, F, 55kD; transcription initiation factor TFIID subunit 7; TAFII55; |
Gene ID | 6879 |
mRNA Refseq | NM_005642 |
Protein Refseq | NP_005633 |
MIM | 600573 |
Uniprot ID | Q15545 |
Chromosome Location | 5q31 |
Pathway | Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; |
Function | histone acetyltransferase binding; protein binding; contributes_to sequence-specific DNA binding transcription factor activity; thyroid hormone receptor binding; transcription coactivator activity; |
◆ Recombinant Proteins | ||
TAF7-4610R | Recombinant Rhesus monkey TAF7 Protein, His-tagged | +Inquiry |
TAF7-8971M | Recombinant Mouse TAF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF7-3107H | Recombinant Human TAF7, GST-tagged | +Inquiry |
TAF7-4426R | Recombinant Rhesus Macaque TAF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF7-16401M | Recombinant Mouse TAF7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF7-1266HCL | Recombinant Human TAF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAF7 Products
Required fields are marked with *
My Review for All TAF7 Products
Required fields are marked with *
0
Inquiry Basket