Recombinant Human T
Cat.No. : | T-27672TH |
Product Overview : | Recombinant fragment of Human Brachyury / Bry with N terminal proprietary tag, 36.52kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW |
Sequence Similarities : | Contains 1 T-box DNA-binding domain. |
Gene Name | T T, brachyury homolog (mouse) [ Homo sapiens ] |
Official Symbol | T |
Synonyms | T; T, brachyury homolog (mouse); T brachyury (mouse) homolog; brachyury protein; |
Gene ID | 6862 |
mRNA Refseq | NM_003181 |
Protein Refseq | NP_003172 |
MIM | 601397 |
Uniprot ID | O15178 |
Chromosome Location | 6q27 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
T-6500C | Recombinant Chicken T | +Inquiry |
T-16350M | Recombinant Mouse T Protein | +Inquiry |
RFL22746EF | Recombinant Full Length Enterobacteria Phage T4 Lysis Protein(T) Protein, His-Tagged | +Inquiry |
T-130H | Recombinant Human T Protein, MYC/DDK-tagged | +Inquiry |
T-754B | Recombinant Bacteriophage K3 T protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
T-1294HCL | Recombinant Human T 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All T Products
Required fields are marked with *
My Review for All T Products
Required fields are marked with *
0
Inquiry Basket