Recombinant Human T

• Cat.No.: T-27672TH
• Product Overview: Recombinant fragment of Human Brachyury / Bry with N terminal proprietary tag, 36.52kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 99 amino acids
• Description: The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
• Sequence Similarities: Contains 1 T-box DNA-binding domain.

Gene Information

• Gene Name: T T, brachyury homolog (mouse) [ Homo sapiens ]
• Official Symbol: T
• Synonyms: T; T, brachyury homolog (mouse); T brachyury (mouse) homolog; brachyury protein
• Gene ID: 6862
• mRNA Refseq: NM_003181
• Protein Refseq: NP_003172
• MIM: 601397
• Uniprot ID: O15178
• Chromosome Location: 6q27
• Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity