Recombinant Human SYNGAP1 Protein (1161-1343 aa), His-tagged
Cat.No. : | SYNGAP1-2648H |
Product Overview : | Recombinant Human SYNGAP1 Protein (1161-1343 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1161-1343 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SYNGAP1 synaptic Ras GTPase activating protein 1 [ Homo sapiens ] |
Official Symbol | SYNGAP1 |
Synonyms | SYNGAP1; KIAA1938; RASA5; SYNGAP; neuronal RasGAP; synaptic Ras GTPase-activating protein 1; MRD5; RASA1; DKFZp761G1421; |
Gene ID | 8831 |
mRNA Refseq | NM_006772 |
Protein Refseq | NP_006763 |
MIM | 603384 |
UniProt ID | Q96PV0 |
◆ Recombinant Proteins | ||
SYNGAP1-2745H | Recombinant Human SYNGAP1 Protein, His-tagged | +Inquiry |
SYNGAP1-2648H | Recombinant Human SYNGAP1 Protein (1161-1343 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYNGAP1 Products
Required fields are marked with *
My Review for All SYNGAP1 Products
Required fields are marked with *
0
Inquiry Basket