Recombinant Human SYCE3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SYCE3-2583H
• Product Overview: C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.4 kDa
• AA Sequence: MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SYCE3 synaptonemal complex central element protein 3 [ Homo sapiens (human) ]
• Official Symbol: SYCE3
• Synonyms: SYCE3; synaptonemal complex central element protein 3; THEG2; C22orf41; synaptonemal complex central element protein 3; testis highly expressed gene 2 protein; testis highly expressed protein 2
• Gene ID: 644186
• mRNA Refseq: NM_001123225
• Protein Refseq: NP_001116697
• MIM: 615775
• UniProt ID: A1L190