Recombinant Human SWAP70, GST-tagged
Cat.No. : | SWAP70-97H |
Product Overview : | Recombinant Human SWAP70(378 a.a. - 451 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Switch-associated protein 70 is a protein that in humans and other mammals is encoded by the SWAP70 gene. |
Molecular Mass : | 33.88 kDa |
AA Sequence : | QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SWAP70 SWAP switching B-cell complex 70kDa subunit [ Homo sapiens ] |
Official Symbol | SWAP70 |
Synonyms | SWAP70; SWAP switching B-cell complex 70kDa subunit; switch-associated protein 70; KIAA0640; SWAP 70; HSPC321; SWAP-70; FLJ39540 |
Gene ID | 23075 |
mRNA Refseq | NM_015055 |
Protein Refseq | NP_055870 |
MIM | 604762 |
UniProt ID | Q9UH65 |
Chromosome Location | 11p15 |
Function | ATP binding; DNA binding; calcium ion binding |
◆ Recombinant Proteins | ||
SWAP70-8899M | Recombinant Mouse SWAP70 Protein, His (Fc)-Avi-tagged | +Inquiry |
SWAP70-517HF | Recombinant Full Length Human SWAP70 Protein, GST-tagged | +Inquiry |
SWAP70-2847C | Recombinant Chicken SWAP70 | +Inquiry |
SWAP70-98H | Recombinant Human SWAP70 protein, His-tagged | +Inquiry |
Swap70-6236M | Recombinant Mouse Swap70 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SWAP70-1325HCL | Recombinant Human SWAP70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SWAP70 Products
Required fields are marked with *
My Review for All SWAP70 Products
Required fields are marked with *
0
Inquiry Basket