Recombinant Human SUPT4H1

• Cat.No.: SUPT4H1-31480TH
• Product Overview: Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa.

Specification

• Description: Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene.
• Protein length: 117 amino acids
• Molecular Weight: 38.940kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Widely expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
• Sequence Similarities: Belongs to the SPT4 family.
• Tag: Non

Gene Information

• Gene Name: SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUPT4H1
• Synonyms: SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H
• Gene ID: 6827
• mRNA Refseq: NM_003168
• Protein Refseq: NP_003159
• MIM: 603555
• Uniprot ID: P63272
• Chromosome Location: 17q21-q23
• Pathway: Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem
• Function: metal ion binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; zinc ion binding