Recombinant Human Suppressor Of Cytokine Signaling 3, GST-tagged

• Cat.No.: SOCS3-6941H
• Product Overview: RecombinantHuman SOCS3 protein wasexpressed as GST-tagged fusion protein by vitro wheatgerm.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SOCS3is a protein that in humans is encoded by the SOCS3 gene. This gene encodes amember of the STAT-induced STAT inhibitor (SSI), also known as suppressor ofcytokine signaling (SOCS), family. SSI family members are cytokine-induciblenegative regulators of cytokine signaling. The expression of this gene isinduced by various cytokines, including IL6, IL10, and interferon(IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, andinhibit the activity of JAK2 kinase.
• Quality ControlTesting: 12.5%SDS-PAGE Stained with Coomassie Blue.
• Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• Preparation Method: in vitro wheatgerm expression system
• Molecular Weight: 50.49 kDa
• Purification: GlutathioneSepharose 4 Fast Flow.
• Buffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Storage: Storeat -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SOCS3 suppressor of cytokine signaling 3 [ Homosapiens ]
• Official Symbol: SOCS3
• Synonyms: SOCS3;suppressor of cytokine signaling 3; CIS3; SSI3; ATOD4; Cish3;SSI-3; SOCS-3; MGC71791; CIS-3; STAT-induced STAT inhibitor 3; cytokine-inducedSH2 protein 3; cytokine-inducible SH2 protein 3
• Gene ID: 9021
• mRNA Refseq: NM_003955
• Protein Refseq: NP_003946
• MIM: 604176
• UniProt ID: O14543
• Chromosome Location: 17q25.3
• Pathway: ATF-2 transcription factor network; Adipocytokinesignaling pathway; Class I MHC mediated antigen processing & presentation;Cytokine Signaling in Immune system; ECS complex; EGFR1 Signaling Pathway; EPOsignaling pathway; Growth hormone receptor signaling; Herpes simplexinfection; IL-2 Signaling Pathway; IL-3 Signaling Pathway; IL-4 SignalingPathway; IL-6 Signaling Pathway; IL-9 Signaling Pathway
• Function: protein kinase inhibitor activity