Recombinant Human SUMO4 protein, GST-tagged

Cat.No. : SUMO4-4514H
Product Overview : Recombinant Human SUMO4 protein(Q6EEV6)(1-95aa), fused to N-terminal GST tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.7 kDa
Protein length : 1-95aa
AA Sequence : MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SUMO4 SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUMO4
Synonyms SUMO4; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 4 (yeast) , SMT3H4; small ubiquitin-related modifier 4; dJ281H8.4; SMT3 suppressor of mif two 3 homolog 2; small ubiquitin-like modifier 4 protein; IDDM5; SMT3H4; SUMO-4;
Gene ID 387082
mRNA Refseq NM_001002255
Protein Refseq NP_001002255
MIM 608829
UniProt ID Q6EEV6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SUMO4 Products

Required fields are marked with *

My Review for All SUMO4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon