Recombinant Human SUMO4 protein, GST-tagged
Cat.No. : | SUMO4-4514H |
Product Overview : | Recombinant Human SUMO4 protein(Q6EEV6)(1-95aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-95aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SUMO4 SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUMO4 |
Synonyms | SUMO4; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 4 (yeast) , SMT3H4; small ubiquitin-related modifier 4; dJ281H8.4; SMT3 suppressor of mif two 3 homolog 2; small ubiquitin-like modifier 4 protein; IDDM5; SMT3H4; SUMO-4; |
Gene ID | 387082 |
mRNA Refseq | NM_001002255 |
Protein Refseq | NP_001002255 |
MIM | 608829 |
UniProt ID | Q6EEV6 |
◆ Recombinant Proteins | ||
SUMO4-3015H | Recombinant Human SUMO4 Protein, His-tagged | +Inquiry |
SUMO4-4514H | Recombinant Human SUMO4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMO4-1723HCL | Recombinant Human SUMO4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUMO4 Products
Required fields are marked with *
My Review for All SUMO4 Products
Required fields are marked with *
0
Inquiry Basket