Recombinant Human SUMO4 protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	37.7 kDa
Protein length :	1-95aa
AA Sequence :	MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Name	SUMO4 SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae) [ Homo sapiens ]
Official Symbol	SUMO4
Synonyms	SUMO4; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 4 (yeast) , SMT3H4; small ubiquitin-related modifier 4; dJ281H8.4; SMT3 suppressor of mif two 3 homolog 2; small ubiquitin-like modifier 4 protein; IDDM5; SMT3H4; SUMO-4;
Gene ID	387082
mRNA Refseq	NM_001002255
Protein Refseq	NP_001002255
MIM	608829
UniProt ID	Q6EEV6