Recombinant Human SULT4A1

• Cat.No.: SULT4A1-199H
• Product Overview: Recombinant Human Sulfotransferase 4A1/SULT4A1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu284) of Human SULT4A1.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 1-284 a.a.
• Description: Sulfotransferase 4A1 (ST4A1) is a member of the Sulfotransferase 1 family. ST4A1 is highly expressed in the cerebral cortex and frontal lobe, but no expression is detected in the pancreas. ST4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. ST4A1 acts on catecholamines and T4 in a manner that may not involve sulfonation. ST4A1 may have a role in the metabolism of drugs and neurotransmitters in the CNS. In addition, ST4A1 is related to schizophrenia.
• Form: Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
• AA Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVV YLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIY MARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLK YEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVS MNEKFDLVYKQKMGKCDLTFDFYL
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: SULT4A1 sulfotransferase family 4A, member 1 [ Homo sapiens ]
• Official Symbol: SULT4A1
• Synonyms: SULT4A1; sulfotransferase family 4A, member 1; sulfotransferase 4A1; hBR STL 1; SULTX3; ST4A1; hBR-STL; nervous system sulfotransferase; sulfotransferase-related protein; brain sulfotransferase-like protein; nervous system cytosolic sulfotransferase; NST; BRSTL1; BR-STL-1; DJ388M5.3; hBR-STL-1; MGC40032
• Gene ID: 25830
• mRNA Refseq: NM_014351
• Protein Refseq: NP_055166
• MIM: 608359
• UniProt ID: Q9BR01
• Chromosome Location: 22q13.2
• Pathway: Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem
• Function: sulfotransferase activity; transferase activity