Recombinant Human SULT1A4 protein, His-tagged

Cat.No. : SULT1A4-2691H
Product Overview : Recombinant Human SULT1A4 protein(1-295 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability April 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-295 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SULT1A4
Synonyms SULT1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4; GALPHA; MTDPS9; SUCLA1; succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; SCS-alpha; succinyl-CoA synthetase subunit alpha; succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial; Aryl Sulfotransferase 1A3/1A4; Catecholamine-Sulfating Phenol Sulfotransferase; Monoamine-Sulfating Phenol Sulfotransferase; Placental Estrogen Sulfotransferase; Sulfotransferase, Monoamine-Preferring; Thermolabile Phenol Sulfotransferase; HAST3; M-PST; ST1A3/ST1A4; TL-PST; EC 2.8.2.1; sulfokinase; Sulfotransferase 1A3/1A4; STM; EC 2.8.2
Gene ID 445329
mRNA Refseq NM_001017390
Protein Refseq NP_001017390
UniProt ID P50224

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SULT1A4 Products

Required fields are marked with *

My Review for All SULT1A4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon