Recombinant human SULT1A3 protein, GST-tagged

• Cat.No.: SULT1A3-3545h
• Product Overview: Recombinant human SULT1A3 protein(P0DMM9)(1-295aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: human
• Source: E.coli
• Tag: GST
• Protein Length: 1-295aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 61.2 kDa
• AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SULT1A3 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 [ Homo sapiens ]
• Official Symbol: SULT1A3
• Synonyms: SULT1A3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; STM; sulfotransferase 1A3/1A4; TL PST; sulfokinase; phenol sulfotransferase 1A5; aryl sulfotransferase 1A3/1A4; dopamine-specific sulfotransferase; placental estrogen sulfotransferase; monoamine-sulfating phenosulfotransferase; catecholamine-sulfating phenol sulfotransferase; thermolabile (monoamine, M form) phenol sulfotransferase; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4; MGC117469
• Gene ID: 6818
• mRNA Refseq: NM_177552
• Protein Refseq: NP_808220
• MIM: 600641
• UniProt ID: P50224