Recombinant Human STYXL1 Protein, GST-tagged

• Cat.No.: STYXL1-4047H
• Product Overview: Human DUSP24 full-length ORF ( AAH24035, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: STYXL1 (Serine/Threonine/Tyrosine Interacting Like 1) is a Protein Coding gene. GO annotations related to this gene include protein tyrosine/serine/threonine phosphatase activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.95 kDa
• AA Sequence: MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: STYXL1 serine/threonine/tyrosine interacting-like 1 [ Homo sapiens ]
• Official Symbol: STYXL1
• Synonyms: STYXL1; serine/threonine/tyrosine interacting-like 1; dual specificity phosphatase 24 (putative) , DUSP24; serine/threonine/tyrosine-interacting-like protein 1; MK STYX; dual specificity protein phosphatase 24; dual specificity phosphatase 24 (putative); map kinase phosphatase-like protein MK-STYX; dual specificity phosphatase inhibitor MK-STYX; DUSP24; MK-STYX
• Gene ID: 51657
• mRNA Refseq: NM_016086
• Protein Refseq: NP_057170
• MIM: 616695
• UniProt ID: Q9Y6J8