Recombinant Human STRN3 protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length :	Ser207-Glu300
AA Sequence :	SNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE
Purity :	90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability :	Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Name	STRN3 striatin, calmodulin binding protein 3 [ Homo sapiens ]
Official Symbol	STRN3
Synonyms	STRN3; striatin, calmodulin binding protein 3; striatin-3; cell cycle S/G2 nuclear autoantigen; SG2NA; s/G2 antigen; nuclear autoantigen; cell cycle autoantigen SG2NA;
Gene ID	29966
mRNA Refseq	NM_001083893
Protein Refseq	NP_001077362
UniProt ID	Q13033