Recombinant Human STRAP, His-tagged
Cat.No. : | STRAP-31671TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 119-350 of Human Unrip with an N terminal His tag; Predicted MWt: 27 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 119-350 a.a. |
Description : | Serine-threonine kinase receptor-associated protein is an enzyme that in humans is encoded by the STRAP gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 54 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQI LSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGE ILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE KEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVR FSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA |
Gene Name | STRAP serine/threonine kinase receptor associated protein [ Homo sapiens ] |
Official Symbol | STRAP |
Synonyms | STRAP; serine/threonine kinase receptor associated protein; serine-threonine kinase receptor-associated protein; MAWD; pt wd; Unr interacting protein; UNRIP; |
Gene ID | 11171 |
mRNA Refseq | NM_007178 |
Protein Refseq | NP_009109 |
MIM | 605986 |
Uniprot ID | Q9Y3F4 |
Chromosome Location | 12p13.1 |
Pathway | RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Survival motor neuron (SMN) complex, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem; |
Function | protein binding; receptor binding; |
◆ Recombinant Proteins | ||
STRAP-2956H | Recombinant Human STRAP Protein, MYC/DDK-tagged | +Inquiry |
STRAP-1259HFL | Recombinant Full Length Human STRAP Protein, C-Flag-tagged | +Inquiry |
STRAP-10633Z | Recombinant Zebrafish STRAP | +Inquiry |
STRAP-3020H | Recombinant Human STRAP, His-tagged | +Inquiry |
STRAP-5805R | Recombinant Rat STRAP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STRAP-642HCL | Recombinant Human STRAP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STRAP Products
Required fields are marked with *
My Review for All STRAP Products
Required fields are marked with *
0
Inquiry Basket