Recombinant Human STRA6 protein(1-50aa), hFc-tagged

Source :	Yeast
Species :	Human
Tag :	Fc
Protein length :	1-50aa
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	33.4 kDa
AASequence :	MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Name	STRA6 stimulated by retinoic acid gene 6 homolog (mouse) [ Homo sapiens ]
Official Symbol	STRA6
Synonyms	STRA6; stimulated; stimulated by retinoic acid gene 6 protein homolog; FLJ12541; MCOPS9; PP14296;
Gene ID	64220
mRNA Refseq	NM_001142617
Protein Refseq	NP_001136089
MIM	610745
UniProt ID	Q9BX79