Recombinant Human STRA6 protein(1-50aa), hFc-tagged
Cat.No. : | STRA6-6567H |
Product Overview : | Recombinant Human STRA6 protein(Q9BX79)(1-50aa), fused with C-terminal hFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Yeast |
Species : | Human |
Tag : | Fc |
Protein length : | 1-50aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
AASequence : | MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | STRA6 stimulated by retinoic acid gene 6 homolog (mouse) [ Homo sapiens ] |
Official Symbol | STRA6 |
Synonyms | STRA6; stimulated; stimulated by retinoic acid gene 6 protein homolog; FLJ12541; MCOPS9; PP14296; |
Gene ID | 64220 |
mRNA Refseq | NM_001142617 |
Protein Refseq | NP_001136089 |
MIM | 610745 |
UniProt ID | Q9BX79 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All STRA6 Products
Required fields are marked with *
My Review for All STRA6 Products
Required fields are marked with *
0
Inquiry Basket