Recombinant Human STOM

• Cat.No.: STOM-31472TH
• Product Overview: Recombinant fragment of Human STOM with N-terminal proprietary tag. Predicted MW 34.87kDa.

Specification

• Description: Erythrocyte band 7 integral membrane protein is a protein that in humans is encoded by the STOM gene.
• Protein length: 84 amino acids
• Molecular Weight: 34.870kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Widely expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSA
• Sequence Similarities: Belongs to the band 7/mec-2 family.
• Tag: Non

Gene Information

• Gene Name: STOM stomatin [ Homo sapiens ]
• Official Symbol: STOM
• Synonyms: STOM; stomatin; EPB7, EPB72, erythrocyte membrane protein band 7.2 (stomatin); erythrocyte band 7 integral membrane protein; BND7
• Gene ID: 2040
• mRNA Refseq: NM_004099
• Protein Refseq: NP_004090
• MIM: 133090
• Uniprot ID: P27105
• Chromosome Location: 9q34.1