Recombinant Human STMND1 Protein, GST-tagged

• Cat.No.: STMND1-4282H
• Product Overview: Human FLJ23152 full-length ORF (1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: STMND1 (Stathmin Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include tubulin binding.
• Molecular Mass: 39 kDa
• AA Sequence: MKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: STMND1 stathmin domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: STMND1
• Synonyms: STMND1; stathmin domain containing 1; stathmin domain-containing protein 1
• Gene ID: 401236
• mRNA Refseq: NM_001190766
• Protein Refseq: NP_001177695
• UniProt ID: H3BQB6