Recombinant Human STK40, His-tagged
Cat.No. : | STK40-29510TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 357-435 of Human STK40 with a N terminal His tag; predicted MWt 10kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 357-435 a.a. |
Description : | Serine/threonine-protein kinase 40 is an enzyme that in humans is encoded by the STK40 gene. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 75 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDAR SWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR K |
Gene Name | STK40 serine/threonine kinase 40 [ Homo sapiens ] |
Official Symbol | STK40 |
Synonyms | STK40; serine/threonine kinase 40; serine/threonine-protein kinase 40; MGC4796; SgK495; |
Gene ID | 83931 |
mRNA Refseq | NM_032017 |
Protein Refseq | NP_114406 |
MIM | 609437 |
Uniprot ID | Q8N2I9 |
Chromosome Location | 1p34.3 |
Function | ATP binding; nucleotide binding; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
STK40-831H | Recombinant Human STK40, GST-tagged | +Inquiry |
STK40-29510TH | Recombinant Human STK40, His-tagged | +Inquiry |
STK40-7319H | Recombinant Human STK40 protein(Met1-Lys435), His&GST-tagged | +Inquiry |
STK40-6036C | Recombinant Chicken STK40 | +Inquiry |
STK40-5795R | Recombinant Rat STK40 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STK40-408HCL | Recombinant Human STK40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STK40 Products
Required fields are marked with *
My Review for All STK40 Products
Required fields are marked with *
0
Inquiry Basket