Recombinant Human STK11, His-tagged

Description :	This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Conjugation :	HIS
Source :	E. coli
Tissue specificity :	Ubiquitously expressed. Strongest expression in testis and fetal liver.
Form :	Lyophilised:Reconstitute with 150 μl aqua dest.
Storage buffer :	Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage :	Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	VLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHG YFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKIS DLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSG FKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGS YAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWF RKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADE DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLP KAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR RLSACKQQ
Sequence Similarities :	Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. LKB1 subfamily.Contains 1 protein kinase domain.
Protein length :	116-433 a.a.

Gene Name	STK11 serine/threonine kinase 11 [ Homo sapiens ]
Official Symbol	STK11
Synonyms	STK11; serine/threonine kinase 11; serine/threonine kinase 11 (Peutz Jeghers syndrome); serine/threonine-protein kinase STK11; LKB1; PJS; polarization related protein LKB1;
Gene ID	6794
mRNA Refseq	NM_000455
Protein Refseq	NP_000446
MIM	602216
Uniprot ID	Q15831
Chromosome Location	19p13.3
Pathway	AMPK inhibits chREBP transcriptional activation activity, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Energy dependent regulation of mTOR by LKB1-AMPK, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem;
Function	ATP binding; LRR domain binding; magnesium ion binding; nucleotide binding; p53 binding;

COA

Cat.No. :	STK11-29853TH
Product Overview :	Recombinant fragment, corresponding to amino acids 116-433 of Human LKB1 with an N terminal His tag. Predicted MWt: 36 kDa;