Recombinant Human STBD1, His-tagged

• Cat.No.: STBD1-198H
• Product Overview: Recombinant Human Starch-Binding Domain-Containing Protein 1/STBD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg24-His358) of Human STBD1 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Starch-Binding Domain-Containing Protein 1 (STBD1) is a single-pass type III membrane protein. It is predicted to contain a hydrophobic N terminus and a C-terminal CBM20 glycan binding domain. Genethonin-1 is highly expressed in skeletal and cardiac muscle, but it is not expressed in the pancreas, kidney and lung. STBD1 may have the capability to bind to carbohydrates. It is shown that STBD1 is involved in glycogen metabolism by binding to glycogen and anchoring it to membranes, thereby affecting its cellular localization and its intracellular trafficking to lysosomes.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: RGGPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTK DLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEW GFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVG GSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAV TGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHED KVVHAWWGIHVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: STBD1 starch binding domain 1 [ Homo sapiens ]
• Official Symbol: STBD1
• Synonyms: STBD1; starch binding domain 1; starch-binding domain-containing protein 1; FLJ41801; genethonin 1; GENX 3414; GENEX3414; GENX-3414
• Gene ID: 8987
• mRNA Refseq: NM_003943
• Protein Refseq: NP_003934
• MIM: 607406
• UniProt ID: O95210
• Chromosome Location: 4q21.1
• Pathway: Diurnally regulated genes with circadian orthologs, organism-specific biosystem
• Function: carbohydrate binding; protein binding; starch binding