Recombinant Human STAT3, His-tagged

• Cat.No.: STAT3-2176H
• Product Overview: Recombinant Human STAT3(Met1-Asn175), transcript variant 3, fused with C-terminal 6His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-175 a.a.
• Description: Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
• AA Sequence: MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEID QQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQAN HPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Usage: FOR RESEARCH USE ONLY
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ]
• Official Symbol: STAT3
• Synonyms: APRF; HIES; ADMIO; signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor
• Gene ID: 6774
• mRNA Refseq: NM_213662
• Protein Refseq: NP_998827
• MIM: 102582
• UniProt ID: P40763
• Chromosome Location: 17q21.31
• Pathway: AGE/RAGE pathway, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cellular responses to stress, organism-specific biosystem
• Function: CCR5 chemokine receptor binding; DNA binding; protein binding