Recombinant Human STAT3, His-tagged
Cat.No. : | STAT3-2176H |
Product Overview : | Recombinant Human STAT3(Met1-Asn175), transcript variant 3, fused with C-terminal 6His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-175 a.a. |
Description : | Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
AA Sequence : | MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEID QQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQAN HPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Usage : | FOR RESEARCH USE ONLY |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ] |
Official Symbol | STAT3 |
Synonyms | APRF; HIES; ADMIO; signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor |
Gene ID | 6774 |
mRNA Refseq | NM_213662 |
Protein Refseq | NP_998827 |
MIM | 102582 |
UniProt ID | P40763 |
Chromosome Location | 17q21.31 |
Pathway | AGE/RAGE pathway, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cellular responses to stress, organism-specific biosystem |
Function | CCR5 chemokine receptor binding; DNA binding; protein binding |
◆ Recombinant Proteins | ||
STAT3-2174H | Recombinant Human STAT3, MYC/DDK-tagged | +Inquiry |
STAT3-30H | Recombinant Human STAT3 protein, His-tagged | +Inquiry |
STAT3-1735C | Recombinant Cattle STAT3 protein, His-tagged | +Inquiry |
STAT3-951H | Recombinant Human STAT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STAT3-2620C | Recombinant Chicken STAT3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT3 Products
Required fields are marked with *
My Review for All STAT3 Products
Required fields are marked with *
0
Inquiry Basket