Recombinant Human STAT3 protein, His-tagged

• Cat.No.: STAT3-30H
• Product Overview: Recombinant Human STAT3, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 21.8kD
• AA Sequence: MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ]
• Official Symbol: STAT3
• Synonyms: STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); signal transducer and activator of transcription 3; APRF; DNA-binding protein APRF; acute-phase response factor; HIES; FLJ20882; MGC16063
• Gene ID: 6774
• mRNA Refseq: NM_003150
• Protein Refseq: NP_003141
• MIM: 102582
• UniProt ID: P40763
• Chromosome Location: 17q21
• Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem
• Function: CCR5 chemokine receptor binding; DNA binding; calcium ion binding; glucocorticoid receptor binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; non-membrane spanning protein tyrosine kinase activity; protein binding; protein dimerization activity; protein kinase binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding