Recombinant Human STAT1 protein, GST-tagged

• Cat.No.: STAT1-2996H
• Product Overview: Recombinant Human STAT1 protein(2-230 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 2-230 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: STAT1 signal transducer and activator of transcription 1, 91kDa [ Homo sapiens ]
• Official Symbol: STAT1
• Synonyms: STAT1; signal transducer and activator of transcription 1, 91kDa; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1-alpha/beta; ISGF 3; STAT91; transcription factor ISGF 3 components p91/p84; transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription-1; CANDF7; ISGF-3; DKFZp686B04100
• Gene ID: 6772
• mRNA Refseq: NM_007315
• Protein Refseq: NP_009330
• MIM: 600555
• UniProt ID: P42224