Recombinant Human STAP2 protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length :	Val201-His403
AA Sequence :	VRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability :	Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Name	STAP2 signal transducing adaptor family member 2 [ Homo sapiens ]
Official Symbol	STAP2
Synonyms	STAP2; signal transducing adaptor family member 2; signal-transducing adaptor protein 2; BKS; STAP 2; BRK substrate; brk kinase substrate; breast tumor kinase substrate; signal-transducing adaptor protein-2; FLJ20234;
Gene ID	55620
mRNA Refseq	NM_001013841
Protein Refseq	NP_001013863
MIM	607881
UniProt ID	Q9UGK3