Recombinant Human ST8SIA4 Protein (21-168 aa), His-SUMO-tagged

• Cat.No.: ST8SIA4-1067H
• Product Overview: Recombinant Human ST8SIA4 Protein (21-168 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein.

Specification

• Description: Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the bryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 32.8 kDa
• Protein length: 21-168 aa
• AA Sequence: KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ST8SIA4 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 [ Homo sapiens ]
• Official Symbol: ST8SIA4
• Synonyms: ST8SIA4; PST; PST1; ST8Sia IV; SIAT8-D; ST8SiaIV; SIAT8D; ST8SIA-IV; MGC34450; MGC61459
• Gene ID: 7903
• mRNA Refseq: NM_005668
• Protein Refseq: NP_005659
• MIM: 602547
• UniProt ID: Q92187