Recombinant Human ST8SIA1 Protein (AA 50-356), N-6×His/GFP tagged

• Cat.No.: ST8SIA1-19H
• Product Overview: Recombinant Human ST8SIA1 Protein (AA 50-356) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Description: Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: His&GFP
• Molecular Mass: ~70 kDa
• Protein length: AA 50-356
• AA Sequence: RLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: ST8SIA1 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: ST8SIA1
• Synonyms: ST8SIA1; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1; sialyltransferase 8 (alpha N acetylneuraminate: alpha 2,8 sialytransferase, GD3 synthase) A , SIAT8, SIAT8A; alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; ST8Sia I; ganglioside GD3 synthase; ganglioside GT3 synthase; sialytransferase St8Sia I; alpha-2,8-sialyltransferase 8A; disialoganglioside (GD3) synthase; ganglioside-specific alpha-2,8-polysialyltransferase; sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3 synthase) A; sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, GD3 synthase); GD3S; SIAT8; SIAT8A; SIAT8-A; ST8SiaI
• Gene ID: 6489
• mRNA Refseq: NM_003034
• Protein Refseq: NP_003025
• MIM: 601123
• UniProt ID: Q92185