Recombinant Human ST8SIA1

• Cat.No.: ST8SIA1-30852TH
• Product Overview: Recombinant fragment of Human ST8SIA1 with N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEAN
• Sequence Similarities: Belongs to the glycosyltransferase 29 family.

Gene Information

• Gene Name: ST8SIA1 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [ Homo sapiens ]
• Official Symbol: ST8SIA1
• Synonyms: ST8SIA1; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1; sialyltransferase 8 (alpha N acetylneuraminate: alpha 2,8 sialytransferase, GD3 synthase) A , SIAT8, SIAT8A; alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; ST8Sia I
• Gene ID: 6489
• mRNA Refseq: NM_003034
• Protein Refseq: NP_003025
• MIM: 601123
• Uniprot ID: Q92185
• Chromosome Location: 12p12.1-p11.2
• Pathway: Ganglio Sphingolipid Metabolism, organism-specific biosystem; Glycosphingolipid biosynthesis - ganglio series, organism-specific biosystem; Glycosphingolipid biosynthesis - ganglio series, conserved biosystem; Glycosphingolipid biosynthesis - globo series, organism-specific biosystem; Glycosphingolipid biosynthesis - globo series, conserved biosystem
• Function: alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity; sialyltransferase activity; transferase activity, transferring glycosyl groups