Recombinant Human ST3GAL6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ST3GAL6-2808H
• Product Overview: ST3GAL6 MS Standard C13 and N15-labeled recombinant protein (NP_006091) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5'-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (gangliosides) or to the N- or O-linked sugar chains of glycoproteins. This protein has high specificity for neolactotetraosylceramide and neolactohexaosylceramide as glycolipid substrates and may contribute to the formation of selectin ligands and sialyl Lewis X, a carbohydrate important for cell-to-cell recognition and a blood group antigen.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 38.2 kDa
• AA Sequence: MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQDSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ST3GAL6 ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [ Homo sapiens (human) ]
• Official Symbol: ST3GAL6
• Synonyms: ST3GAL6; ST3 beta-galactoside alpha-2,3-sialyltransferase 6; sialyltransferase 10 (alpha 2,3 sialyltransferase VI), SIAT10; type 2 lactosamine alpha-2,3-sialyltransferase; ST3GALVI; ST3Gal VI; alpha2,3-sialyltransferase; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; SIAT10
• Gene ID: 10402
• mRNA Refseq: NM_006100
• Protein Refseq: NP_006091
• MIM: 607156
• UniProt ID: Q9Y274