Recombinant Human SSX3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SSX3-3705H |
Product Overview : | SSX3 MS Standard C13 and N15-labeled recombinant protein (NP_066294) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SSX3 SSX family member 3 [ Homo sapiens (human) ] |
Official Symbol | SSX3 |
Synonyms | SSX3; synovial sarcoma, X breakpoint 3; protein SSX3; CT5.3; cancer/testis antigen 5.3; synovial sarcoma, X breakpoint 3, isoform a; MGC14495; MGC119054; |
Gene ID | 10214 |
mRNA Refseq | NM_021014 |
Protein Refseq | NP_066294 |
MIM | 300325 |
UniProt ID | Q99909 |
◆ Recombinant Proteins | ||
SSX3-3705H | Recombinant Human SSX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SSX3-2974H | Recombinant Human SSX3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX3-1447HCL | Recombinant Human SSX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSX3 Products
Required fields are marked with *
My Review for All SSX3 Products
Required fields are marked with *
0
Inquiry Basket