Recombinant Human SST protein, Myc/DDK-tagged

• Cat.No.: SST-01H
• Product Overview: Recombinant protein of human somatostatin (SST) was expressed in HEK293T, with a Myc/DDK tag.

Specification

• Description: The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.
• Source: HEK293T
• Species: Human
• Tag: Myc&DDK
• Form: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Molecular Mass: 10.3 kDa
• AA Sequence: MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method

Gene Information

• Gene Name: SST somatostatin [ Homo sapiens (human) ]
• Official Symbol: SST
• Synonyms: SMST; SST1
• Gene ID: 6750
• mRNA Refseq: NM_001048
• Protein Refseq: NP_001039
• MIM: 182450
• UniProt ID: P61278