Recombinant Human SSPN protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length :	Met1-Leu73
AA Sequence :	MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability :	Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Name	SSPN sarcospan [ Homo sapiens ]
Official Symbol	SSPN
Synonyms	SSPN; sarcospan; KRAG, Kras oncogene associated gene; SPN1; SPN2; nanospan; microspan; Kras oncogene-associated; kirsten-ras-associated protein; K-ras oncogene-associated protein; sarcospan (Kras oncogene-associated gene); KRAG; NSPN; DAGA5;
Gene ID	8082
mRNA Refseq	NM_001135823
Protein Refseq	NP_001129295
MIM	601599
UniProt ID	Q14714