Recombinant Human SSBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SSBP3-1653H
• Product Overview: SSBP3 MS Standard C13 and N15-labeled recombinant protein (NP_663768) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SSBP3 (Single Stranded DNA Binding Protein 3) is a Protein Coding gene. Diseases associated with SSBP3 include Prostate Carcinoma In Situ and Panhypopituitarism, X-Linked. Gene Ontology (GO) annotations related to this gene include single-stranded DNA binding. An important paralog of this gene is SSBP2.
• Molecular Mass: 40.4 kDa
• AA Sequence: MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SSBP3 single stranded DNA binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: SSBP3
• Synonyms: SSBP3; single stranded DNA binding protein 3; single-stranded DNA-binding protein 3; CSDP; FLJ10355; SSDP; SSDP1; sequence-specific single-stranded-DNA-binding protein
• Gene ID: 23648
• mRNA Refseq: NM_145716
• Protein Refseq: NP_663768
• MIM: 607390
• UniProt ID: Q9BWW4