Recombinant Human SRXN1 protein(1-137aa), His&Myc-tagged

• Cat.No.: SRXN1-3928H
• Product Overview: Recombinant Human SRXN1 protein(Q9BYN0)(1-137aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-137aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.9 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS

Gene Information

• Gene Name: SRXN1 sulfiredoxin 1 [ Homo sapiens ]
• Official Symbol: SRXN1
• Synonyms: SRXN1; sulfiredoxin 1; C20orf139, chromosome 20 open reading frame 139 , sulfiredoxin 1 homolog (S. cerevisiae); sulfiredoxin-1; dJ850E9.2; Npn3; SRX1; YKL086W; sulfiredoxin 1 homolog; C20orf139; FLJ43353
• Gene ID: 140809
• mRNA Refseq: NM_080725
• Protein Refseq: NP_542763
• UniProt ID: Q9BYN0