Recombinant Human SRSF9 protein, His-tagged
Cat.No. : | SRSF9-09H |
Product Overview : | Recombinant Human SRSF9(1-221aa) fused with His tag at N-terminal was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-221 a.a. |
Description : | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
AA Sequence : | MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGY DYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMV EYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | SRSF9 serine/arginine-rich splicing factor 9 [ Homo sapiens ] |
Official Symbol | SRSF9 |
Synonyms | SFRS9; SRp30c |
Gene ID | 8683 |
mRNA Refseq | NM_003769.2 |
Protein Refseq | NP_003760.1 |
MIM | 601943 |
UniProt ID | Q13242 |
Chromosome Location | 12q24.31 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem;Gene ex |
Function | RNA binding;nucleotide binding; |
◆ Recombinant Proteins | ||
SRSF9-10H | Recombinant Human SRSF9 protein, GST-tagged | +Inquiry |
SRSF9-5750R | Recombinant Rat SRSF9 Protein | +Inquiry |
SRSF9-16017M | Recombinant Mouse SRSF9 Protein | +Inquiry |
SRSF9-09H | Recombinant Human SRSF9 protein, His-tagged | +Inquiry |
SRSF9-5409R | Recombinant Rat SRSF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRSF9 Products
Required fields are marked with *
My Review for All SRSF9 Products
Required fields are marked with *
0
Inquiry Basket