Recombinant Human SRSF4

• Cat.No.: SRSF4-26856TH
• Product Overview: Recombinant fragment of Human SFRS4 with N-terminal proprietary tag. Predicted MW 34.10 kDa.

Specification

• Description: This gene encodes a member of the arginine/serine-rich splicing factor family. The encoded protein likely functions in mRNA processing.
• Protein length: 77 amino acids
• Molecular Weight: 34.100kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVE
• Sequence Similarities: Belongs to the splicing factor SR family.Contains 2 RRM (RNA recognition motif) domains.
• Tag: Non

Gene Information

• Gene Name: SRSF4 serine/arginine-rich splicing factor 4 [ Homo sapiens ]
• Official Symbol: SRSF4
• Synonyms: SRSF4; serine/arginine-rich splicing factor 4; SFRS4, splicing factor, arginine/serine rich 4; SR splicing factor 4; SRP75
• Gene ID: 6429
• mRNA Refseq: NM_005626
• Protein Refseq: NP_005617
• MIM: 601940
• Uniprot ID: Q08170
• Chromosome Location: 1p35.3
• Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: RNA binding; nucleotide binding