Recombinant Human SRRM2 Protein (1666-2089 aa), His-Myc-tagged
Cat.No. : | SRRM2-2781H |
Product Overview : | Recombinant Human SRRM2 Protein (1666-2089 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1666-2089 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.8 kDa |
AA Sequence : | RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSR |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SRRM2 serine/arginine repetitive matrix 2 [ Homo sapiens ] |
Official Symbol | SRRM2 |
Synonyms | CWF21; Cwc21; 300-KD; SRL300; SRm300; |
Gene ID | 23524 |
mRNA Refseq | NM_016333.3 |
Protein Refseq | NP_057417.3 |
MIM | 606032 |
UniProt ID | Q9UQ35 |
◆ Recombinant Proteins | ||
SRRM2-16004M | Recombinant Mouse SRRM2 Protein | +Inquiry |
SRRM2-8730M | Recombinant Mouse SRRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRRM2-3215Z | Recombinant Zebrafish SRRM2 | +Inquiry |
SRRM2-2781H | Recombinant Human SRRM2 Protein (1666-2089 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRRM2 Products
Required fields are marked with *
My Review for All SRRM2 Products
Required fields are marked with *
0
Inquiry Basket